SCOPe 2.08: Domain d5ner1_: 5ner 1:

Lineage for d5ner1_ (5ner 1:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (27 species)
   not a true protein

7. Species Foot-and-mouth disease virus [TaxId:12110] [188180] (9 PDB entries)

8. Domain d5ner1_: 5ner 1: [335672]
   Other proteins in same PDB: d5nera1, d5nera2
   automated match to d1qqp1_
   complexed with ca, man, nag

Details for d5ner1_

PDB Entry: 5ner, 11.5 Å

PDB Description: localised reconstruction of alpha v beta 6 bound to foot and mouth disease virus o panasia - pose a prime.

PDB Compounds: (1:) O PanAsia VP1

SCOPe Domain Sequences for d5ner1_:

Sequence; same for both SEQRES and ATOM records:

>d5ner1_ b.121.4.1 (1:) automated matches {Foot-and-mouth disease virus [TaxId: 12110]}
ttsagesadpvtatvenyggetqvqrrqhtdvsfildrfvkvtpkdqinvldlmqtpaht
lvgallrtatyyfadlevavkhegnltwvpngapetaldnttnptayhkapltrlalpyt
aphrvlatvyngnckygeshttnvrgdlqvlaqkvartlptsfnygaikatrvtellyrm
kraetycprpllaihpsearhkqkivapvk

Timeline for d5ner1_:

• d5ner1_ first appeared in SCOPe 2.06
  
• d5ner1_ appears in SCOPe 2.07