![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
![]() | Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
![]() | Protein automated matches [191156] (12 species) not a true protein |
![]() | Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (33 PDB entries) |
![]() | Domain d5o2uc_: 5o2u C: [335669] Other proteins in same PDB: d5o2ub_, d5o2ud_ automated match to d2koda_ |
PDB Entry: 5o2u (more details), 2.76 Å
SCOPe Domain Sequences for d5o2uc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o2uc_ a.28.3.0 (C:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} sildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpg atleemmtacqgv
Timeline for d5o2uc_: