Lineage for d5o2uc_ (5o2u C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706557Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2706558Protein automated matches [191156] (12 species)
    not a true protein
  7. 2706577Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (33 PDB entries)
  8. 2706619Domain d5o2uc_: 5o2u C: [335669]
    Other proteins in same PDB: d5o2ub_, d5o2ud_
    automated match to d2koda_

Details for d5o2uc_

PDB Entry: 5o2u (more details), 2.76 Å

PDB Description: llama vhh in complex with p24
PDB Compounds: (C:) capsid protein p24

SCOPe Domain Sequences for d5o2uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o2uc_ a.28.3.0 (C:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
sildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpg
atleemmtacqgv

SCOPe Domain Coordinates for d5o2uc_:

Click to download the PDB-style file with coordinates for d5o2uc_.
(The format of our PDB-style files is described here.)

Timeline for d5o2uc_: