SCOPe 2.07: Domain d5o2uc_: 5o2u C:

Lineage for d5o2uc_ (5o2u C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (10 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (12 PDB entries)

8. Domain d5o2uc_: 5o2u C: [335669]
   Other proteins in same PDB: d5o2ub_, d5o2ud_
   automated match to d2koda_

Details for d5o2uc_

PDB Entry: 5o2u, 2.76 Å

PDB Description: llama vhh in complex with p24

PDB Compounds: (C:) capsid protein p24

SCOPe Domain Sequences for d5o2uc_:

Sequence; same for both SEQRES and ATOM records:

>d5o2uc_ a.28.3.0 (C:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
sildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpg
atleemmtacqgv

Timeline for d5o2uc_:

• d5o2uc_ first appeared in SCOPe 2.06