Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (58 species) not a true protein |
Species Rhodospirillum rubrum [TaxId:269796] [335612] (2 PDB entries) |
Domain d5l8fh_: 5l8f H: [335668] Other proteins in same PDB: d5l8fb2, d5l8fg2, d5l8fi2 automated match to d1zpyg_ complexed with mg, pge; mutant |
PDB Entry: 5l8f (more details), 2.25 Å
SCOPe Domain Sequences for d5l8fh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l8fh_ a.25.1.0 (H:) automated matches {Rhodospirillum rubrum [TaxId: 269796]} stheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrdeakeaa amtlewlrrndakwaehlrtylftegpita
Timeline for d5l8fh_: