Lineage for d5lhua1 (5lhu A:1-210)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2522032Protein automated matches [190140] (38 species)
    not a true protein
  7. 2522208Species Mycobacterium tuberculosis [TaxId:83332] [335655] (5 PDB entries)
  8. 2522211Domain d5lhua1: 5lhu A:1-210 [335657]
    Other proteins in same PDB: d5lhua2
    automated match to d1nh8a1
    complexed with gol, his, so4

Details for d5lhua1

PDB Entry: 5lhu (more details), 2.02 Å

PDB Description: atp phosphoribosyltransferase from mycobacterium tuberculosis in complex with the allosteric inhibitor l-histidine
PDB Compounds: (A:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d5lhua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lhua1 c.94.1.1 (A:1-210) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mlrvavpnkgalsepateilaeagyrrrtdskdltvidpvnnveffflrpkdiaiyvgsg
eldfgitgrdlvcdsgaqvrerlalgfgsssfryaapagrnwttadlagmriataypnlv
rkdlatkgieatvirldgaveisvqlgvadaiadvvgsgrtlsqhdlvafgeplcdseav
lieragtdgqdqteardqlvarvqgvvfgq

SCOPe Domain Coordinates for d5lhua1:

Click to download the PDB-style file with coordinates for d5lhua1.
(The format of our PDB-style files is described here.)

Timeline for d5lhua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5lhua2