![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein automated matches [190140] (37 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [335655] (5 PDB entries) |
![]() | Domain d5lhua1: 5lhu A:1-210 [335657] Other proteins in same PDB: d5lhua2 automated match to d1nh8a1 complexed with gol, his, so4 |
PDB Entry: 5lhu (more details), 2.02 Å
SCOPe Domain Sequences for d5lhua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lhua1 c.94.1.1 (A:1-210) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} mlrvavpnkgalsepateilaeagyrrrtdskdltvidpvnnveffflrpkdiaiyvgsg eldfgitgrdlvcdsgaqvrerlalgfgsssfryaapagrnwttadlagmriataypnlv rkdlatkgieatvirldgaveisvqlgvadaiadvvgsgrtlsqhdlvafgeplcdseav lieragtdgqdqteardqlvarvqgvvfgq
Timeline for d5lhua1: