Lineage for d5neu1_ (5neu 1:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409884Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2410108Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2410109Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 protein domains)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2410393Protein automated matches [190854] (15 species)
    not a true protein
  7. 2410428Species Foot-and-mouth disease virus [TaxId:12110] [188180] (8 PDB entries)
  8. 2410442Domain d5neu1_: 5neu 1: [335656]
    Other proteins in same PDB: d5neua1, d5neua2
    automated match to d1qqp1_
    complexed with ca, mg

Details for d5neu1_

PDB Entry: 5neu (more details), 12.3 Å

PDB Description: localised reconstruction of integrin alpha v beta 6 bound to foot and mouth disease virus o1 manisa - pose b.
PDB Compounds: (1:) O1 Manisa VP1

SCOPe Domain Sequences for d5neu1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5neu1_ b.121.4.1 (1:) automated matches {Foot-and-mouth disease virus [TaxId: 12110]}
ttsagesadpvtatvenyggetqvqrrqhtdvsfildrfvkvtpkdqinvldlmqtpaht
lvgallrtatyyfadlevavkhegnltwvpngapeaaldnttnptayhkapltrlalpyt
aphrvlatvyngnskygdgtvanvrgdlqvlaqkaaralptsfnygaikatrvtellyrm
kraetycprpllaihpdqarhkqkivap

SCOPe Domain Coordinates for d5neu1_:

Click to download the PDB-style file with coordinates for d5neu1_.
(The format of our PDB-style files is described here.)

Timeline for d5neu1_: