Class b: All beta proteins [48724] (177 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.2: Pilus subunits [49405] (10 proteins) |
Protein automated matches [190569] (10 species) not a true protein |
Species Escherichia coli [TaxId:83333] [269237] (20 PDB entries) |
Domain d5l4ya_: 5l4y A: [335610] automated match to d4csta_ complexed with 6k3 |
PDB Entry: 5l4y (more details), 1.9 Å
SCOPe Domain Sequences for d5l4ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l4ya_ b.2.3.2 (A:) automated matches {Escherichia coli [TaxId: 83333]} facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
Timeline for d5l4ya_: