SCOPe 2.08: Domain d5kk8b1: 5kk8 B:2-149

Lineage for d5kk8b1 (5kk8 B:2-149)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (18 species)
   not a true protein

7. Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [330659] (3 PDB entries)

8. Domain d5kk8b1: 5kk8 B:2-149 [335601]
   Other proteins in same PDB: d5kk8a2, d5kk8b2
   automated match to d5bxib_
   complexed with adp

Details for d5kk8b1

PDB Entry: 5kk8, 2.11 Å

PDB Description: crystal structure of nucleoside diphosphate kinase from schistosoma mansoni in complex with adp

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5kk8b1:

Sequence; same for both SEQRES and ATOM records:

>d5kk8b1 d.58.6.1 (B:2-149) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
ertfimvkpdgvqrglvgeviqrferrgyklvaikmmhaseqllqthyealkslsffpkl
vaymssgpvvpmvfegrkvvengrtmlgatkpeascpgsirgdycqdvgrnvvhgsdste
sanreinlwfspqelcqykqavdpwihe

Timeline for d5kk8b1:

• d5kk8b1 first appeared in SCOPe 2.06
  
• d5kk8b1 appears in SCOPe 2.07