Lineage for d1kvca_ (1kvc A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 836757Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) (S)
    consists of one domain of this fold
  5. 836758Family c.55.3.1: Ribonuclease H [53099] (4 proteins)
  6. 836890Protein RNase H (RNase HI) [53100] (3 species)
  7. 836891Species Escherichia coli [TaxId:562] [53101] (30 PDB entries)
    Uniprot P0A7Y4
  8. 836914Domain d1kvca_: 1kvc A: [33560]
    mutant

Details for d1kvca_

PDB Entry: 1kvc (more details), 1.9 Å

PDB Description: e. coli ribonuclease hi d134n mutant
PDB Compounds: (A:) Ribonuclease H

SCOP Domain Sequences for d1kvca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kvca_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
ehcevilstdsqyvrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwew
vkghaghpenercnelaraaamnptledtgyqvev

SCOP Domain Coordinates for d1kvca_:

Click to download the PDB-style file with coordinates for d1kvca_.
(The format of our PDB-style files is described here.)

Timeline for d1kvca_: