Lineage for d5k41a_ (5k41 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. Protein automated matches [190965] (40 species)
    not a true protein
  7. Species Mycobacterium thermoresistibile [TaxId:1797] [334098] (7 PDB entries)
  8. Domain d5k41a_: 5k41 A: [335598]
    automated match to d5hxaa_
    complexed with adq, edo, nhe

Details for d5k41a_

PDB Entry: 5k41 (more details), 1.97 Å

PDB Description: structure of mycobacterium thermoresistibile trehalose-6-phosphate synthase in a complex with adp-glucose.
PDB Compounds: (A:) alpha,alpha-trehalose-phosphate synthase

SCOPe Domain Sequences for d5k41a_:

Sequence, based on SEQRES records: (download)

>d5k41a_ c.87.1.0 (A:) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
sgdsdfvvvanrlpidlerapdgttswkrspgglvtalepllrrrrgawigwpgipdsde
dpivdgdlvlypvrlsaddvaqyyegfsnatlwplyhdvivkpiynrqwweryvevnrrf
aeatsraaargatvwvqdyqlqlvpkmlrelrpdltigfflhipfppvelfmqlpwrtei
tdgllgadlvgfhlpggaqnflflarrlvgantsrasvgvrskfgevqigsrtvkvgafp
isidsadldrqarqrsirqrarqiraelgnprrillgvdrldytkgidvrlqafaellae
grvnredtvfvqlatpsrerveayrllrddierqvghingeygevghpvvhylhrpvpre
eliaffvaadvmlvtplrdgmnlvakeyvacrsdlggalvlseftgaaaelgqaylvnph
nldhvkdtmvaalnqtpeegrrrmralrrqvlahdvdlwarsfldalastr

Sequence, based on observed residues (ATOM records): (download)

>d5k41a_ c.87.1.0 (A:) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
sgdsdfvvvanrlpidlswkrspgglvtalepllrrrrgawigwpgipdsdedpivdgdl
vlypvrlsaddvaqyyegfsnatlwplyhdvivkpiynrqwweryvevnrrfaeatsraa
argatvwvqdyqlqlvpkmlrelrpdltigfflhipfppvelfmqlpwrteitdgllgad
lvgfhlpggaqnflflarrlvgantsrasvgvrskfgevqigsrtvkvgafpisidsadl
drqarqrsirqrarqiraelgnprrillgvdrldytkgidvrlqafaellaegrvnredt
vfvqlatpsrerveayrllrddierqvghingeygevghpvvhylhrpvpreeliaffva
advmlvtplrdgmnlvakeyvacrsdlggalvlseftgaaaelgqaylvnphnldhvkdt
mvaalnqtpeegrrrmralrrqvlahdvdlwarsfldalastr

SCOPe Domain Coordinates for d5k41a_ are not available.

Timeline for d5k41a_: