Lineage for d5gmac1 (5gma C:1-323)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901488Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins)
    Pfam PF05448; AXE1
  6. 2901489Protein Acetyl xylan esterase TM0077 [110693] (1 species)
  7. 2901490Species Thermotoga maritima [TaxId:2336] [110694] (5 PDB entries)
    Uniprot Q9WXT2
  8. 2901505Domain d5gmac1: 5gma C:1-323 [335587]
    Other proteins in same PDB: d5gmaa2, d5gmab2, d5gmac2, d5gmad2, d5gmae2, d5gmaf2
    automated match to d1l7aa_
    complexed with act

Details for d5gmac1

PDB Entry: 5gma (more details), 2.1 Å

PDB Description: crystal structure of the p228a variant of thermotoga maritima acetyl esterase
PDB Compounds: (C:) Cephalosporin-C deacetylase

SCOPe Domain Sequences for d5gmac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gmac1 c.69.1.25 (C:1-323) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]}
maffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvt
fsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgq
gsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqe
riviaggsqgggialavsalskkakallcdvpflchfrravqlvdthayaeitnflkthr
dkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypy
nnhegggsfqaveqvkflkklfe

SCOPe Domain Coordinates for d5gmac1:

Click to download the PDB-style file with coordinates for d5gmac1.
(The format of our PDB-style files is described here.)

Timeline for d5gmac1: