Lineage for d5tkmb_ (5tkm B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918718Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
    strand 5 is parallel to strand 4
    Pfam PF08210; Pfam PF05240
  6. 2918779Protein automated matches [310855] (2 species)
    not a true protein
  7. 2918780Species Human (Homo sapiens) [TaxId:9606] [311219] (20 PDB entries)
  8. 2918796Domain d5tkmb_: 5tkm B: [335566]
    automated match to d3vm8a_
    complexed with zn

Details for d5tkmb_

PDB Entry: 5tkm (more details), 1.9 Å

PDB Description: crystal structure of human apobec3b n-terminal domain
PDB Compounds: (B:) DNA dC->dU-editing enzyme APOBEC-3B

SCOPe Domain Sequences for d5tkmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tkmb_ c.97.1.6 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
npmermdrdtfydnfenepilsgrsytwlcyevkikrgrsnllwdtgvfrgqvyfkpqyh
aemcflswfcgnqlpadkcfqitwfvswtpcpdcvaklaeflsehpnvtltisaarlyyy
serdyrralcrlsqagarvkimdyeefaycwenfvdnegqqfmpwykfdenyaflhrtlk
eilr

SCOPe Domain Coordinates for d5tkmb_:

Click to download the PDB-style file with coordinates for d5tkmb_.
(The format of our PDB-style files is described here.)

Timeline for d5tkmb_: