![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily) multihelical bundle; contains buried central helix |
![]() | Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) ![]() |
![]() | Family a.89.1.0: automated matches [227272] (1 protein) not a true family |
![]() | Protein automated matches [227075] (6 species) not a true protein |
![]() | Species Methanotorris formicicus [TaxId:647171] [335416] (2 PDB entries) |
![]() | Domain d5n2ab2: 5n2a B:189-444 [335560] Other proteins in same PDB: d5n2ab1, d5n2ac_ automated match to d1hbnb1 complexed with br, com, f43, k, tp7 |
PDB Entry: 5n2a (more details), 2.8 Å
SCOPe Domain Sequences for d5n2ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n2ab2 a.89.1.0 (B:189-444) automated matches {Methanotorris formicicus [TaxId: 647171]} gyalrnimvnhyvattkknimnavafasimeqtamfemgdaigsferlhllglayqglna dnlvidlvkangkngtvgtvvasiveraledgvitedkkmpsgfvlykpvdvakwnayaa aglvaavivncgaaraaqnvastilyyndiieyetglpgvdfgraegtavgfsffshsiy ggggpgifngnhivtrhskgfaippvcaamcvdagtqmfspektsalvgavfsaidefre plkyvidgalavkdki
Timeline for d5n2ab2: