Lineage for d1rbra_ (1rbr A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1172062Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1172063Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 1172205Protein RNase H (RNase HI) [53100] (3 species)
  7. 1172206Species Escherichia coli [TaxId:562] [53101] (33 PDB entries)
    Uniprot P0A7Y4
  8. 1172217Domain d1rbra_: 1rbr A: [33556]
    mutant

Details for d1rbra_

PDB Entry: 1rbr (more details), 1.8 Å

PDB Description: structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d1rbra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rbra_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
epcevilstdsqyvrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwew
vkghaghpenercdelaraaamnptledtgyqvev

SCOPe Domain Coordinates for d1rbra_:

Click to download the PDB-style file with coordinates for d1rbra_.
(The format of our PDB-style files is described here.)

Timeline for d1rbra_: