Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) consists of one domain of this fold |
Family c.55.3.1: Ribonuclease H [53099] (4 proteins) |
Protein RNase H (RNase HI) [53100] (3 species) |
Species Escherichia coli [TaxId:562] [53101] (30 PDB entries) Uniprot P0A7Y4 |
Domain d1rbra_: 1rbr A: [33556] mutant |
PDB Entry: 1rbr (more details), 1.8 Å
SCOP Domain Sequences for d1rbra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rbra_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk epcevilstdsqyvrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwew vkghaghpenercdelaraaamnptledtgyqvev
Timeline for d1rbra_: