SCOPe 2.06: Domain d5n1qb1: 5n1q B:2-188

Lineage for d5n1qb1 (5n1q B:2-188)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families)
   each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

5. Family d.58.31.0: automated matches [227271] (1 protein)
   not a true family

6. Protein automated matches [227074] (4 species)
   not a true protein

7. Species Methanothermococcus thermolithotrophicus [TaxId:523845] [335401] (1 PDB entry)

8. Domain d5n1qb1: 5n1q B:2-188 [335553]
   Other proteins in same PDB: d5n1qb2, d5n1qe2
   automated match to d1hbnb2
   complexed with com, f43, gol, k, mg, tp7

Details for d5n1qb1

PDB Entry: 5n1q, 1.9 Å

PDB Description: methyl-coenzyme m reductase iii from methanothermococcus thermolithotrophicus at 1.9 a resolution

PDB Compounds: (B:) methyl-coenzyme m reductase III from methanothermococcus thermolithotrophicus subunit beta

SCOPe Domain Sequences for d5n1qb1:

Sequence; same for both SEQRES and ATOM records:

>d5n1qb1 d.58.31.0 (B:2-188) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 523845]}
vkyedkislydakgnlvedgvpleaisplynptikamvknikrtvavnlagienslktga
iggkgckvpgrtldlpivenaeaimdevekilritpdddtqlraindgkqlvvqvpskrl
evaaeysvsmlntamalkeaiiktfdvdlfdgstihaaivgrypqvmdymggniasllga
psnmegl

Timeline for d5n1qb1:

• d5n1qb1 is new in SCOPe 2.06-stable
  
• d5n1qb1 appears in SCOPe 2.07
  
• d5n1qb1 appears in the current release, SCOPe 2.08