SCOP 1.73: Domain d1rbta_: 1rbt A:

Lineage for d1rbta_ (1rbt A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (12 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (4 proteins)

6. Protein RNase H (RNase HI) [53100] (3 species)

7. Species Escherichia coli [TaxId:562] [53101] (30 PDB entries)

8. Domain d1rbta_: 1rbt A: [33555]
   mutant

Details for d1rbta_

PDB Entry: 1rbt, 1.8 Å

PDB Description: structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability

PDB Compounds: (A:) Ribonuclease H

SCOP Domain Sequences for d1rbta_:

Sequence; same for both SEQRES and ATOM records:

>d1rbta_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
ehcevilstdsqyvrqgitqwihnwkkrgwktadgkpvknvdlwqrldaalgqhqikwew
vkghaghpenercdelaraaamnptledtgyqvev

Timeline for d1rbta_:

• d1rbta_ first appeared (with stable ids) in SCOP 1.55, called d1rbt__
  
• d1rbta_ was called d1rbt__ in SCOP 1.71
  
• d1rbta_ appears in SCOP 1.75
  
• d1rbta_ appears in the current release, SCOPe 2.08