SCOPe 2.06: Domain d5n1qe2: 5n1q E:189-443

Lineage for d5n1qe2 (5n1q E:189-443)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
   multihelical bundle; contains buried central helix

4. Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families)

5. Family a.89.1.0: automated matches [227272] (1 protein)
   not a true family

6. Protein automated matches [227075] (4 species)
   not a true protein

7. Species Methanothermococcus thermolithotrophicus [TaxId:523845] [335548] (1 PDB entry)

8. Domain d5n1qe2: 5n1q E:189-443 [335549]
   Other proteins in same PDB: d5n1qb1, d5n1qc_, d5n1qe1, d5n1qf_
   automated match to d1hbnb1
   complexed with com, f43, gol, k, mg, tp7

Details for d5n1qe2

PDB Entry: 5n1q, 1.9 Å

PDB Description: methyl-coenzyme m reductase iii from methanothermococcus thermolithotrophicus at 1.9 a resolution

PDB Compounds: (E:) methyl-coenzyme m reductase III from methanothermococcus thermolithotrophicus subunit beta

SCOPe Domain Sequences for d5n1qe2:

Sequence; same for both SEQRES and ATOM records:

>d5n1qe2 a.89.1.0 (E:189-443) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 523845]}
gyalrnimvnhyvattkknlmnavafasimeqtamfemgdaigsfermhllglayqglns
dnlvidlvkanskgtvgtvvasvveraledkvivedkslesgftmykpadvakwnayaaa
glvaavivncgaaraaqnvastilyyndileyetglpgtdfgraegtavgfsffshsiyg
gggpgiftgnhvvtrhskgfaippvcaamcadagtqmfspektsalvgavysaidefrep
lkyviegalevkdki

Timeline for d5n1qe2:

• d5n1qe2 is new in SCOPe 2.06-stable
  
• d5n1qe2 appears in SCOPe 2.07
  
• d5n1qe2 appears in the current release, SCOPe 2.08