SCOP 1.71: Domain d1lav__: 1lav -

Lineage for d1lav__ (1lav -)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein RNase H (RNase HI) [53100] (3 species)

7. Species Escherichia coli [TaxId:562] [53101] (27 PDB entries)

8. Domain d1lav__: 1lav - [33554]
   mutant

Details for d1lav__

PDB Entry: 1lav, 1.8 Å

PDB Description: stabilization of escherichia coli ribonuclease hi by cavity-filling mutations within a hydrophobic core

SCOP Domain Sequences for d1lav__:

Sequence; same for both SEQRES and ATOM records:

>d1lav__ c.55.3.1 (-) RNase H (RNase HI) {Escherichia coli}
mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
ehcevilstdsqylrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwew
vkghaghpenercdelaraaamnptledtgyqvev

Timeline for d1lav__:

• d1lav__ first appeared (with stable ids) in SCOP 1.55
  
• d1lav__ appears in SCOP 1.69
  
• d1lav__ is called d1lava_ in SCOP 1.73
  
• d1lav__ appears in the current release, SCOPe 2.08, called d1lava_