Lineage for d5t0df_ (5t0d F:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645407Protein Influenza hemagglutinin (stalk) [58066] (17 species)
    trimer
  7. 2645520Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries)
  8. 2645867Domain d5t0df_: 5t0d F: [335521]
    Other proteins in same PDB: d5t0da_, d5t0dc_, d5t0de_
    automated match to d4kdmb_
    complexed with gal, nag, sia; mutant

Details for d5t0df_

PDB Entry: 5t0d (more details), 2.86 Å

PDB Description: crystal structure of h6 hemagglutinin g225d mutant from taiwan (2013) h6n1 influenza virus in complex with 3'-sln
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5t0df_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t0df_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqg

SCOPe Domain Coordinates for d5t0df_:

Click to download the PDB-style file with coordinates for d5t0df_.
(The format of our PDB-style files is described here.)

Timeline for d5t0df_: