SCOPe 2.08: Domain d5xajc1: 5xaj C:1-110

Lineage for d5xajc1 (5xaj C:1-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5xajc1: 5xaj C:1-110 [335517]
   Other proteins in same PDB: d5xaja_, d5xajb2, d5xajc2, d5xajd2, d5xajh_, d5xajl2
   automated match to d1lila1

Details for d5xajc1

PDB Entry: 5xaj, 2.5 Å

PDB Description: structural mimicry of the dengue virus envelope glycoprotein revealed by the crystallographic study of an idiotype-anti-idiotype fab complex.

PDB Compounds: (C:) Fab E1 light chain

SCOPe Domain Sequences for d5xajc1:

Sequence; same for both SEQRES and ATOM records:

>d5xajc1 b.1.1.0 (C:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsyeltqppsvsvapgqtarmtcggnnigtksvhwyqqkpgqapvlvvyndrdrpsgipe
rfsgsnsgntatltisrvedgdeadyfcqvwdnysdhvifgggtkltvlg

Timeline for d5xajc1:

• d5xajc1 first appeared in SCOPe 2.06
  
• d5xajc1 appears in SCOPe 2.07