| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily) Core: 3 helices; irregular array; disulfide-rich |
Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families) ![]() automatically mapped to Pfam PF01392 |
| Family a.141.1.0: automated matches [274414] (1 protein) not a true family |
| Protein automated matches [274417] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [274420] (8 PDB entries) |
| Domain d5uwga_: 5uwg A: [335516] automated match to d5bqcb_ complexed with nag, pam |
PDB Entry: 5uwg (more details), 2.56 Å
SCOPe Domain Sequences for d5uwga_:
Sequence, based on SEQRES records: (download)
>d5uwga_ a.141.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvyv
pmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcmegp
>d5uwga_ a.141.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvyv
pmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqnhmcmegp
Timeline for d5uwga_: