SCOPe 2.08: Domain d5uwga_: 5uwg A:

Lineage for d5uwga_ (5uwg A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily)
   Core: 3 helices; irregular array; disulfide-rich

4. Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families)
   automatically mapped to Pfam PF01392

5. Family a.141.1.0: automated matches [274414] (1 protein)
   not a true family

6. Protein automated matches [274417] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [274420] (11 PDB entries)

8. Domain d5uwga_: 5uwg A: [335516]
   automated match to d5bqcb_
   complexed with nag, pam

Details for d5uwga_

PDB Entry: 5uwg, 2.56 Å

PDB Description: the crystal structure of fz4-crd in complex with palmitoleic acid

PDB Compounds: (A:) Frizzled-4

SCOPe Domain Sequences for d5uwga_:

Sequence, based on SEQRES records:

>d5uwga_ a.141.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvyv
pmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcmegp

Sequence, based on observed residues (ATOM records):

>d5uwga_ a.141.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvyv
pmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqnhmcmegp

Timeline for d5uwga_:

• d5uwga_ first appeared in SCOPe 2.06
  
• d5uwga_ appears in SCOPe 2.07