Lineage for d2rn2a_ (2rn2 A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701966Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) (S)
    consists of one domain of this fold
  5. 701967Family c.55.3.1: Ribonuclease H [53099] (4 proteins)
  6. 702096Protein RNase H (RNase HI) [53100] (3 species)
  7. 702097Species Escherichia coli [TaxId:562] [53101] (30 PDB entries)
  8. 702100Domain d2rn2a_: 2rn2 A: [33551]

Details for d2rn2a_

PDB Entry: 2rn2 (more details), 1.48 Å

PDB Description: structural details of ribonuclease h from escherichia coli as refined to an atomic resolution
PDB Compounds: (A:) Ribonuclease H

SCOP Domain Sequences for d2rn2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rn2a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
ehcevilstdsqyvrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwew
vkghaghpenercdelaraaamnptledtgyqvev

SCOP Domain Coordinates for d2rn2a_:

Click to download the PDB-style file with coordinates for d2rn2a_.
(The format of our PDB-style files is described here.)

Timeline for d2rn2a_: