SCOPe 2.06: Domain d5w15c1: 5w15 C:1-267

Lineage for d5w15c1 (5w15 C:1-267)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Burkholderia ambifaria [TaxId:398577] [335497] (1 PDB entry)

8. Domain d5w15c1: 5w15 C:1-267 [335501]
   Other proteins in same PDB: d5w15a2, d5w15b2, d5w15c2, d5w15d2
   automated match to d4lxga_
   complexed with cl, edo, mg

Details for d5w15c1

PDB Entry: 5w15, 1.75 Å

PDB Description: crystal structure of an alpha/beta hydrolase fold protein from burkholderia ambifaria.

PDB Compounds: (C:) Alpha/beta hydrolase fold protein

SCOPe Domain Sequences for d5w15c1:

Sequence; same for both SEQRES and ATOM records:

>d5w15c1 c.69.1.0 (C:1-267) automated matches {Burkholderia ambifaria [TaxId: 398577]}
mldlanrfnfeghriawgtlgegpplvlvhgtpfssqvwrriapwlarrhrvffydllgy
gqsdmpdadvslgrqnvlfgalldewkisrprvlahdyggatvlrahfldgiaysdltlv
npvaiapqgspfvrhvaqheaaftglpayahhalvsayigqavaqplsddvlsiyrapwl
tpagqaafyrqiaqmrqryiedaearyappdfpvrivwgeddrwipleqgqaladriang
klirvpraghlvqedapeaivaavldr

Timeline for d5w15c1:

• d5w15c1 is new in SCOPe 2.06-stable
  
• d5w15c1 appears in SCOPe 2.07
  
• d5w15c1 appears in the current release, SCOPe 2.08