Lineage for d5w1fg_ (5w1f G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710100Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2710101Protein Calcyclin (S100) [47479] (17 species)
  7. 2710164Species Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId:9606] [47487] (8 PDB entries)
    Migration inhibitory factor-related protein 8
  8. 2710201Domain d5w1fg_: 5w1f G: [335490]
    Other proteins in same PDB: d5w1fb_, d5w1fd_, d5w1ff_, d5w1fh_
    automated match to d1xk4a1
    complexed with ca, na, ni

Details for d5w1fg_

PDB Entry: 5w1f (more details), 2.6 Å

PDB Description: crystal structure of ni(ii)- and ca(ii)-bound human calprotectin
PDB Compounds: (G:) Protein S100-A8

SCOPe Domain Sequences for d5w1fg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w1fg_ a.39.1.2 (G:) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}
mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
ntdgavnfqeflilvikmgvaahkkshe

SCOPe Domain Coordinates for d5w1fg_:

Click to download the PDB-style file with coordinates for d5w1fg_.
(The format of our PDB-style files is described here.)

Timeline for d5w1fg_: