SCOPe 2.05: Domain d1jawa1: 1jaw A:1-176

Lineage for d1jawa1 (1jaw A:1-176)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families)

5. Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 proteins)

6. Protein Aminopeptidase P [53096] (2 species)
   synonym: Xaa-Pro dipeptidase, prolidase

7. Species Escherichia coli [TaxId:562] [53097] (19 PDB entries)

8. Domain d1jawa1: 1jaw A:1-176 [33549]
   Other proteins in same PDB: d1jawa2
   complexed with act, mn

Details for d1jawa1

PDB Entry: 1jaw, 2.7 Å

PDB Description: aminopeptidase p from e. coli low ph form

PDB Compounds: (A:) aminopeptidase p

SCOPe Domain Sequences for d1jawa1:

Sequence; same for both SEQRES and ATOM records:

>d1jawa1 c.55.2.1 (A:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwygrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

Timeline for d1jawa1:

• d1jawa1 first appeared (with stable ids) in SCOP 1.55, called d1jaw_1
  
• d1jawa1 appears in SCOPe 2.04
  
• d1jawa1 appears in SCOPe 2.06
  
• d1jawa1 appears in the current release, SCOPe 2.08