SCOPe 2.08: Domain d5vc1a1: 5vc1 A:1-118

Lineage for d5vc1a1 (5vc1 A:1-118)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)

8. Domain d5vc1a1: 5vc1 A:1-118 [335485]
   Other proteins in same PDB: d5vc1a2
   automated match to d1g1ta1
   complexed with ca, gol, peg, pg4

Details for d5vc1a1

PDB Entry: 5vc1, 1.94 Å

PDB Description: crystal structure of l-selectin lectin/egf domains

PDB Compounds: (A:) L-selectin

SCOPe Domain Sequences for d5vc1a1:

Sequence; same for both SEQRES and ATOM records:

>d5vc1a1 d.169.1.0 (A:1-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wtyhysekpmnwqrarrfcrdqytdlvaiqnkaeieylektlpfsrsyywigirkiggiw
twvgtnkslteeaenwgdgepnnkknkedcveiyikrnkdagkwnddachklkaalcy

Timeline for d5vc1a1:

• d5vc1a1 first appeared in SCOPe 2.06
  
• d5vc1a1 appears in SCOPe 2.07