Lineage for d5vc1a1 (5vc1 A:1-118)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002332Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)
  8. 3002514Domain d5vc1a1: 5vc1 A:1-118 [335485]
    Other proteins in same PDB: d5vc1a2
    automated match to d1g1ta1
    complexed with ca, gol, peg, pg4

Details for d5vc1a1

PDB Entry: 5vc1 (more details), 1.94 Å

PDB Description: crystal structure of l-selectin lectin/egf domains
PDB Compounds: (A:) L-selectin

SCOPe Domain Sequences for d5vc1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vc1a1 d.169.1.0 (A:1-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wtyhysekpmnwqrarrfcrdqytdlvaiqnkaeieylektlpfsrsyywigirkiggiw
twvgtnkslteeaenwgdgepnnkknkedcveiyikrnkdagkwnddachklkaalcy

SCOPe Domain Coordinates for d5vc1a1:

Click to download the PDB-style file with coordinates for d5vc1a1.
(The format of our PDB-style files is described here.)

Timeline for d5vc1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vc1a2