SCOPe 2.07: Domain d5w1fb_: 5w1f B:

Lineage for d5w1fb_ (5w1f B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein automated matches [190132] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187203] (41 PDB entries)

8. Domain d5w1fb_: 5w1f B: [335480]
   Other proteins in same PDB: d5w1fa_, d5w1fc_, d5w1fe_, d5w1fg_
   automated match to d5i8nb_
   complexed with ca, na, ni

Details for d5w1fb_

PDB Entry: 5w1f, 2.6 Å

PDB Description: crystal structure of ni(ii)- and ca(ii)-bound human calprotectin

PDB Compounds: (B:) Protein S100-A9

SCOPe Domain Sequences for d5w1fb_:

Sequence; same for both SEQRES and ATOM records:

>d5w1fb_ a.39.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehime
dldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglge

Timeline for d5w1fb_:

• d5w1fb_ first appeared in SCOPe 2.06