![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family) ![]() |
![]() | Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins) |
![]() | Protein Aminopeptidase P [53096] (2 species) synonym: Xaa-Pro dipeptidase, prolidase |
![]() | Species Escherichia coli [TaxId:562] [53097] (23 PDB entries) |
![]() | Domain d1a16a1: 1a16 A:1-176 [33548] Other proteins in same PDB: d1a16a2 complexed with mn |
PDB Entry: 1a16 (more details), 2.3 Å
SCOP Domain Sequences for d1a16a1:
Sequence, based on SEQRES records: (download)
>d1a16a1 c.55.2.1 (A:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]} seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk
>d1a16a1 c.55.2.1 (A:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]} seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql lngldvvyhaqgeyayadvivnsleklrkgsrqnltapatmidwrpvvhemrlfk
Timeline for d1a16a1: