Lineage for d1a16_1 (1a16 1-176)
- Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family) 
Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins) Protein Aminopeptidase P [53096] (2 species)
synonym: Xaa-Pro dipeptidase, prolidaseSpecies Escherichia coli [TaxId:562] [53097] (5 PDB entries) 
Domain d1a16_1: 1a16 1-176 [33548]
Other proteins in same PDB: d1a16_2
complexed with mn
Details for d1a16_1
PDB Entry: 1a16 (more details), 2.3 Å
PDB Description: aminopeptidase p from e. coli with the inhibitor pro-leu
SCOP Domain Sequences for d1a16_1:
Sequence, based on SEQRES records: (download)
>d1a16_1 c.55.2.1 (1-176) Aminopeptidase P {Escherichia coli}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk
Sequence, based on observed residues (ATOM records): (download)
>d1a16_1 c.55.2.1 (1-176) Aminopeptidase P {Escherichia coli}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsleklrkgsrqnltapatmidwrpvvhemrlfk
SCOP Domain Coordinates for d1a16_1:
Click to download the PDB-style file with coordinates for d1a16_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a16_1:
- d1a16_1 first appeared (with stable ids) in SCOP 1.55
- d1a16_1 appears in SCOP 1.69
- d1a16_1 is called d1a16a1 in SCOP 1.73
- d1a16_1 appears in the current release, SCOPe 2.08, called d1a16a1
View in 3D
