SCOP 1.69: Domain d1a16_1: 1a16 1-176

Lineage for d1a16_1 (1a16 1-176)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family)

5. Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins)

6. Protein Aminopeptidase P [53096] (2 species)
   synonym: Xaa-Pro dipeptidase, prolidase

7. Species Escherichia coli [TaxId:562] [53097] (5 PDB entries)

8. Domain d1a16_1: 1a16 1-176 [33548]
   Other proteins in same PDB: d1a16_2

Details for d1a16_1

PDB Entry: 1a16, 2.3 Å

PDB Description: aminopeptidase p from e. coli with the inhibitor pro-leu

SCOP Domain Sequences for d1a16_1:

Sequence, based on SEQRES records:

>d1a16_1 c.55.2.1 (1-176) Aminopeptidase P {Escherichia coli}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

Sequence, based on observed residues (ATOM records):

>d1a16_1 c.55.2.1 (1-176) Aminopeptidase P {Escherichia coli}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsleklrkgsrqnltapatmidwrpvvhemrlfk

Timeline for d1a16_1:

• d1a16_1 first appeared (with stable ids) in SCOP 1.55
  
• d1a16_1 appears in SCOP 1.67
  
• d1a16_1 appears in SCOP 1.71
  
• d1a16_1 appears in the current release, SCOPe 2.08, called d1a16a1