Class a: All alpha proteins [46456] (289 folds) |
Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily) dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices |
Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) |
Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins) Pfam PF03271 |
Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (3 species) |
Species Otolemur garnettii [TaxId:30611] [335375] (1 PDB entry) |
Domain d5n74e_: 5n74 E: [335469] automated match to d1wu9a1 |
PDB Entry: 5n74 (more details), 2.3 Å
SCOPe Domain Sequences for d5n74e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n74e_ a.245.1.1 (E:) Microtubule-associated protein EB1, C-terminal dimerization domain {Otolemur garnettii [TaxId: 30611]} elmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
Timeline for d5n74e_: