Lineage for d5t0eb_ (5t0e B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041066Domain d5t0eb_: 5t0e B: [335466]
    Other proteins in same PDB: d5t0ea_, d5t0ec_, d5t0ee_
    automated match to d4kdmb_
    complexed with nag; mutant

Details for d5t0eb_

PDB Entry: 5t0e (more details), 2.09 Å

PDB Description: crystal structure of h6 hemagglutinin g225d mutant from taiwan (2013) h6n1 influenza virus in complex with lsta
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5t0eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t0eb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgi

SCOPe Domain Coordinates for d5t0eb_:

Click to download the PDB-style file with coordinates for d5t0eb_.
(The format of our PDB-style files is described here.)

Timeline for d5t0eb_: