Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family) |
Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins) |
Protein Creatinase [53094] (2 species) |
Species Pseudomonas putida [TaxId:303] [53095] (1 PDB entry) |
Domain d1chmb1: 1chm B:2-156 [33546] Other proteins in same PDB: d1chma2, d1chmb2 complexed with cms |
PDB Entry: 1chm (more details), 1.9 Å
SCOPe Domain Sequences for d1chmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1chmb1 c.55.2.1 (B:2-156) Creatinase {Pseudomonas putida [TaxId: 303]} qmpktlrirngdkvrstfsaqeyanrqarlrahlaaenidaaiftsyhninyysdflycs fgrpyalvvteddvisisanidggqpwrrtvgtdnivytdwqrdnyfaaiqqalpkarri giehdhlnlqnrdklaarypdaelvdvaaacmrmr
Timeline for d1chmb1: