Lineage for d1chmb1 (1chm B:2-156)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701913Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family) (S)
  5. 701914Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins)
  6. 701959Protein Creatinase [53094] (2 species)
  7. 701963Species Pseudomonas putida [TaxId:303] [53095] (1 PDB entry)
  8. 701965Domain d1chmb1: 1chm B:2-156 [33546]
    Other proteins in same PDB: d1chma2, d1chmb2
    complexed with cms

Details for d1chmb1

PDB Entry: 1chm (more details), 1.9 Å

PDB Description: enzymatic mechanism of creatine amidinohydrolase as deduced from crystal structures
PDB Compounds: (B:) creatine amidinohydrolase

SCOP Domain Sequences for d1chmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chmb1 c.55.2.1 (B:2-156) Creatinase {Pseudomonas putida [TaxId: 303]}
qmpktlrirngdkvrstfsaqeyanrqarlrahlaaenidaaiftsyhninyysdflycs
fgrpyalvvteddvisisanidggqpwrrtvgtdnivytdwqrdnyfaaiqqalpkarri
giehdhlnlqnrdklaarypdaelvdvaaacmrmr

SCOP Domain Coordinates for d1chmb1:

Click to download the PDB-style file with coordinates for d1chmb1.
(The format of our PDB-style files is described here.)

Timeline for d1chmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1chmb2