SCOPe 2.08: Domain d5iuee1: 5iue E:2-181

Lineage for d5iuee1 (5iue E:2-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (35 PDB entries)

8. Domain d5iuee1: 5iue E:2-181 [335447]
   Other proteins in same PDB: d5iuea2, d5iueb_, d5iuee2, d5iuef_, d5iueg2, d5iueh_, d5iuei2, d5iuej_
   automated match to d1efxa2
   complexed with nag

Details for d5iuee1

PDB Entry: 5iue, 2.62 Å

PDB Description: human leukocyte antigen f (hla-f) presents peptides and regulates immunity through interactions with nk-cell receptors

PDB Compounds: (E:) cDNA FLJ39643 fis, clone SMINT2004023, highly similar to HLA class I histocompatibility antigen, alphachain F

SCOPe Domain Sequences for d5iuee1:

Sequence; same for both SEQRES and ATOM records:

>d5iuee1 d.19.1.1 (E:2-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shslryfstavsrpgrgepryiaveyvddtqflrfdsdaaiprmeprepwveqegpqywe
wttgyakanaqtdrvalrnllrrynqseagshtlqgmngcdmgpdgrllrgyhqhaydgk
dyislnedlrswtaadtvaqitqrfyeaeeyaeefrtylegeclellrrylengketlqr

Timeline for d5iuee1:

• d5iuee1 first appeared in SCOPe 2.06
  
• d5iuee1 appears in SCOPe 2.07