![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein Green fluorescent protein, GFP [54513] (6 species) |
![]() | Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries) Uniprot P42212 |
![]() | Domain d5b61f_: 5b61 F: [335444] automated match to d3st2a_ |
PDB Entry: 5b61 (more details), 3.12 Å
SCOPe Domain Sequences for d5b61f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b61f_ d.22.1.1 (F:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]} geelftgvvpilveldgdvnghkfsvrgegegdatngkitlklicttgklpvpwptlvtt cgygvqcfarypdhmkrhdffksampegyvqertisfkddgtfktraevkfegdtivnri klkgidfkedgnilghkleynfnshkvyitadkqkngikanfkirhnvedgsvqladhyq qntpigdgpvrlpdnhylstqsviledpnekrdhmvlhefvta
Timeline for d5b61f_: