| Class b: All beta proteins [48724] (178 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) ![]() two constituent families are related by circular permutation |
| Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
| Protein Synaptogamin I [49576] (3 species) duplication: contains tandem repeat of two similar domains |
| Species Mouse (Mus musculus) [TaxId:10090] [335436] (5 PDB entries) |
| Domain d5t0ra_: 5t0r A: [335437] automated match to d2k45a_ complexed with cd |
PDB Entry: 5t0r (more details), 1.95 Å
SCOPe Domain Sequences for d5t0ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t0ra_ b.7.1.2 (A:) Synaptogamin I {Mouse (Mus musculus) [TaxId: 10090]}
klgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhrk
tlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteewr
dlqsa
Timeline for d5t0ra_: