| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily) multihelical bundle; contains buried central helix |
Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) ![]() |
| Family a.89.1.0: automated matches [227272] (1 protein) not a true family |
| Protein automated matches [227075] (6 species) not a true protein |
| Species Methanotorris formicicus [TaxId:647171] [335416] (2 PDB entries) |
| Domain d5n28b2: 5n28 B:189-444 [335435] Other proteins in same PDB: d5n28b1, d5n28c_, d5n28e1, d5n28f_ automated match to d1hbnb1 complexed with com, f43, k, tp7 |
PDB Entry: 5n28 (more details), 2.8 Å
SCOPe Domain Sequences for d5n28b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n28b2 a.89.1.0 (B:189-444) automated matches {Methanotorris formicicus [TaxId: 647171]}
gyalrnimvnhyvattkknimnavafasimeqtamfemgdaigsferlhllglayqglna
dnlvidlvkangkngtvgtvvasiveraledgvitedkkmpsgfvlykpvdvakwnayaa
aglvaavivncgaaraaqnvastilyyndiieyetglpgvdfgraegtavgfsffshsiy
ggggpgifngnhivtrhskgfaippvcaamcvdagtqmfspektsalvgavfsaidefre
plkyvidgalavkdki
Timeline for d5n28b2:
View in 3DDomains from other chains: (mouse over for more information) d5n28c_, d5n28e1, d5n28e2, d5n28f_ |