Lineage for d5n28b2 (5n28 B:189-444)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719655Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2719656Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2719743Family a.89.1.0: automated matches [227272] (1 protein)
    not a true family
  6. 2719744Protein automated matches [227075] (6 species)
    not a true protein
  7. 2719758Species Methanotorris formicicus [TaxId:647171] [335416] (2 PDB entries)
  8. 2719759Domain d5n28b2: 5n28 B:189-444 [335435]
    Other proteins in same PDB: d5n28b1, d5n28c_, d5n28e1, d5n28f_
    automated match to d1hbnb1
    complexed with com, f43, k, tp7

Details for d5n28b2

PDB Entry: 5n28 (more details), 2.8 Å

PDB Description: methyl-coenzyme m reductase iii from methanotorris formicicus monoclinic form
PDB Compounds: (B:) Methyl-coenzyme M reductase, beta subunit

SCOPe Domain Sequences for d5n28b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n28b2 a.89.1.0 (B:189-444) automated matches {Methanotorris formicicus [TaxId: 647171]}
gyalrnimvnhyvattkknimnavafasimeqtamfemgdaigsferlhllglayqglna
dnlvidlvkangkngtvgtvvasiveraledgvitedkkmpsgfvlykpvdvakwnayaa
aglvaavivncgaaraaqnvastilyyndiieyetglpgvdfgraegtavgfsffshsiy
ggggpgifngnhivtrhskgfaippvcaamcvdagtqmfspektsalvgavfsaidefre
plkyvidgalavkdki

SCOPe Domain Coordinates for d5n28b2:

Click to download the PDB-style file with coordinates for d5n28b2.
(The format of our PDB-style files is described here.)

Timeline for d5n28b2: