SCOPe 2.07: Domain d5t08b_: 5t08 B:

Lineage for d5t08b_ (5t08 B:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (14 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)

8. Domain d5t08b_: 5t08 B: [335431]
   Other proteins in same PDB: d5t08a_, d5t08c_, d5t08e_
   automated match to d4kdmb_
   complexed with nag; mutant

Details for d5t08b_

PDB Entry: 5t08, 2.19 Å

PDB Description: crystal structure of h6 hemagglutinin g225d mutant from taiwan (2013) h6n1 influenza virus

PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5t08b_:

Sequence; same for both SEQRES and ATOM records:

>d5t08b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgi

Timeline for d5t08b_:

• d5t08b_ first appeared in SCOPe 2.06