Lineage for d5iueg2 (5iue G:182-275)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756403Domain d5iueg2: 5iue G:182-275 [335420]
    Other proteins in same PDB: d5iuea1, d5iueb_, d5iuee1, d5iuef_, d5iueg1, d5iueh_, d5iuei1, d5iuej_
    automated match to d1efxa1
    complexed with nag

Details for d5iueg2

PDB Entry: 5iue (more details), 2.62 Å

PDB Description: human leukocyte antigen f (hla-f) presents peptides and regulates immunity through interactions with nk-cell receptors
PDB Compounds: (G:) cDNA FLJ39643 fis, clone SMINT2004023, highly similar to HLA class I histocompatibility antigen, alphachain F

SCOPe Domain Sequences for d5iueg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iueg2 b.1.1.0 (G:182-275) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adppkahvahhpisdheatlrcwalgfypaeitltwqrdgeeqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpqplilrwe

SCOPe Domain Coordinates for d5iueg2:

Click to download the PDB-style file with coordinates for d5iueg2.
(The format of our PDB-style files is described here.)

Timeline for d5iueg2: