SCOPe 2.08: Domain d5iueg2: 5iue G:182-275

Lineage for d5iueg2 (5iue G:182-275)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5iueg2: 5iue G:182-275 [335420]
   Other proteins in same PDB: d5iuea1, d5iueb_, d5iuee1, d5iuef_, d5iueg1, d5iueh_, d5iuei1, d5iuej_
   automated match to d1efxa1
   complexed with nag

Details for d5iueg2

PDB Entry: 5iue, 2.62 Å

PDB Description: human leukocyte antigen f (hla-f) presents peptides and regulates immunity through interactions with nk-cell receptors

PDB Compounds: (G:) cDNA FLJ39643 fis, clone SMINT2004023, highly similar to HLA class I histocompatibility antigen, alphachain F

SCOPe Domain Sequences for d5iueg2:

Sequence; same for both SEQRES and ATOM records:

>d5iueg2 b.1.1.0 (G:182-275) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adppkahvahhpisdheatlrcwalgfypaeitltwqrdgeeqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpqplilrwe

Timeline for d5iueg2:

• d5iueg2 first appeared in SCOPe 2.06
  
• d5iueg2 appears in SCOPe 2.07