SCOP 1.71: Domain d1bo5o1: 1bo5 O:2-253

Lineage for d1bo5o1 (1bo5 O:2-253)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families)
   duplication contains two domains of this fold

5. Family c.55.1.4: Glycerol kinase [53089] (1 protein)

6. Protein Glycerol kinase [53090] (2 species)

7. Species Escherichia coli [TaxId:562] [53091] (12 PDB entries)

8. Domain d1bo5o1: 1bo5 O:2-253 [33541]

Details for d1bo5o1

PDB Entry: 1bo5, 3.2 Å

PDB Description: crystal structure of the complex between escherichia coli glycerol kinase and the allosteric regulator fructose 1,6-bisphosphate.

SCOP Domain Sequences for d1bo5o1:

Sequence; same for both SEQRES and ATOM records:

>d1bo5o1 c.55.1.4 (O:2-253) Glycerol kinase {Escherichia coli}
ekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlv
evlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgle
dyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvt
dytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisg
iagdqqaalfgq

Timeline for d1bo5o1:

• d1bo5o1 first appeared (with stable ids) in SCOP 1.55
  
• d1bo5o1 appears in SCOP 1.69
  
• d1bo5o1 appears in SCOP 1.73
  
• d1bo5o1 appears in the current release, SCOPe 2.08