| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.19: Fertilization protein [47081] (1 superfamily) core: 3 helices; bundle, closed, right-handed twist; up-and-down |
Superfamily a.19.1: Fertilization protein [47082] (1 family) ![]() automatically mapped to Pfam PF01303 |
| Family a.19.1.1: Fertilization protein [47083] (3 proteins) |
| Protein automated matches [335347] (1 species) not a true protein |
| Species Red abalone (Haliotis rufescens) [TaxId:6454] [335348] (5 PDB entries) |
| Domain d5mr3g_: 5mr3 G: [335406] automated match to d2lisa_ complexed with cl, gol, nag, pge |
PDB Entry: 5mr3 (more details), 1.8 Å
SCOPe Domain Sequences for d5mr3g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mr3g_ a.19.1.1 (G:) automated matches {Red abalone (Haliotis rufescens) [TaxId: 6454]}
vepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwany
mlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinrmr
padvpvkym
Timeline for d5mr3g_: