SCOPe 2.08: Domain d5t3oa1: 5t3o A:4-160

Lineage for d5t3oa1 (5t3o A:4-160)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [335395] (6 PDB entries)

8. Domain d5t3oa1: 5t3o A:4-160 [335396]
   automated match to d2ji4a1
   complexed with adp, so4

Details for d5t3oa1

PDB Entry: 5t3o, 2.2 Å

PDB Description: crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus

PDB Compounds: (A:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d5t3oa1:

Sequence; same for both SEQRES and ATOM records:

>d5t3oa1 c.61.1.0 (A:4-160) automated matches {Thermus thermophilus [TaxId: 274]}
pllifsgqsnrplaqaiaealglplgksttlrfandnlfvryeeslregdvfivqsfvpp
vqdhlmellmmvdaakgasaarvtavipyfsyarsdkkdaprisitarliadllqtagad
rvltmtlhspqvhgffkipvdhlsaepvianyfatrv

Timeline for d5t3oa1:

• d5t3oa1 first appeared in SCOPe 2.06
  
• d5t3oa1 appears in SCOPe 2.07