Lineage for d5n2ac_ (5n2a C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955026Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2955165Family d.58.31.0: automated matches [227271] (1 protein)
    not a true family
  6. 2955166Protein automated matches [227074] (6 species)
    not a true protein
  7. 2955186Species Methanotorris formicicus [TaxId:647171] [335373] (2 PDB entries)
  8. 2955192Domain d5n2ac_: 5n2a C: [335393]
    Other proteins in same PDB: d5n2ab2
    automated match to d1e6yc_
    complexed with br, com, f43, k, tp7

Details for d5n2ac_

PDB Entry: 5n2a (more details), 2.8 Å

PDB Description: methyl-coenzyme m reductase iii from methanotorris formicicus trigonal form
PDB Compounds: (C:) Methyl-coenzyme M reductase, gamma subunit

SCOPe Domain Sequences for d5n2ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n2ac_ d.58.31.0 (C:) automated matches {Methanotorris formicicus [TaxId: 647171]}
ykpqfypgetkiaqnrrnhmnpeveleklreipdedvvkimghrqpgedyktihppleem
dlpddyvrdlvepingakeghriryiqfadsmyfapaqpydrartymwrfrgvdtgtlsg
rqviemresdlealsknflidtaffdparcgirgatvhghslrldenglmfdalqryvyd
ektghvvyvkdqvgrpldepvdvgellpeeklreittiyrkdgvpmredkelltivkrih
rartlggfcptedtfkql

SCOPe Domain Coordinates for d5n2ac_:

Click to download the PDB-style file with coordinates for d5n2ac_.
(The format of our PDB-style files is described here.)

Timeline for d5n2ac_: