![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.19: Fertilization protein [47081] (1 superfamily) core: 3 helices; bundle, closed, right-handed twist; up-and-down |
![]() | Superfamily a.19.1: Fertilization protein [47082] (1 family) ![]() automatically mapped to Pfam PF01303 |
![]() | Family a.19.1.1: Fertilization protein [47083] (3 proteins) |
![]() | Protein Lysin [47084] (2 species) |
![]() | Species Red abalone (Haliotis rufescens) [TaxId:6454] [47085] (6 PDB entries) |
![]() | Domain d5iiac_: 5iia C: [335389] automated match to d2lisa_ complexed with nag |
PDB Entry: 5iia (more details), 1.7 Å
SCOPe Domain Sequences for d5iiac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iiac_ a.19.1.1 (C:) Lysin {Red abalone (Haliotis rufescens) [TaxId: 6454]} flnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwanymlwi nkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinrmrpadv pvkym
Timeline for d5iiac_: