Lineage for d5kgsa_ (5kgs A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897478Species Mycobacterium bovis [TaxId:233413] [334928] (3 PDB entries)
  8. 2897481Domain d5kgsa_: 5kgs A: [335387]
    automated match to d4cxqa_
    complexed with 6sr, pge, plp

Details for d5kgsa_

PDB Entry: 5kgs (more details), 2.1 Å

PDB Description: crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 5-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]-2, 3-dihydroinden-1-one
PDB Compounds: (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase

SCOPe Domain Sequences for d5kgsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kgsa_ c.67.1.0 (A:) automated matches {Mycobacterium bovis [TaxId: 233413]}
ltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwta
ihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsvs
vevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqvf
apqvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrry
evllifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtisa
gaagalmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavtd
vrvcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsamv
evarlvgsl

SCOPe Domain Coordinates for d5kgsa_:

Click to download the PDB-style file with coordinates for d5kgsa_.
(The format of our PDB-style files is described here.)

Timeline for d5kgsa_: