Lineage for d5ii7a_ (5ii7 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697878Fold a.19: Fertilization protein [47081] (1 superfamily)
    core: 3 helices; bundle, closed, right-handed twist; up-and-down
  4. 2697879Superfamily a.19.1: Fertilization protein [47082] (1 family) (S)
    automatically mapped to Pfam PF01303
  5. 2697880Family a.19.1.1: Fertilization protein [47083] (3 proteins)
  6. 2697902Protein automated matches [335347] (1 species)
    not a true protein
  7. 2697903Species Red abalone (Haliotis rufescens) [TaxId:6454] [335348] (5 PDB entries)
  8. 2697909Domain d5ii7a_: 5ii7 A: [335386]
    automated match to d2lisa_
    complexed with mes, so4

Details for d5ii7a_

PDB Entry: 5ii7 (more details), 1.66 Å

PDB Description: in-house sulfur-sad structure of orthorhombic red abalone lysin at 1.66 a resolution
PDB Compounds: (A:) Egg-lysin

SCOPe Domain Sequences for d5ii7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ii7a_ a.19.1.1 (A:) automated matches {Red abalone (Haliotis rufescens) [TaxId: 6454]}
whyvepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthw
anymlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeein
rmrpadvpvkym

SCOPe Domain Coordinates for d5ii7a_:

Click to download the PDB-style file with coordinates for d5ii7a_.
(The format of our PDB-style files is described here.)

Timeline for d5ii7a_: