Lineage for d5n74c_ (5n74 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351135Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 2351136Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 2351137Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
    Pfam PF03271
  6. 2351138Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (3 species)
  7. 2351167Species Otolemur garnettii [TaxId:30611] [335375] (1 PDB entry)
  8. 2351170Domain d5n74c_: 5n74 C: [335381]
    automated match to d1wu9a1

Details for d5n74c_

PDB Entry: 5n74 (more details), 2.3 Å

PDB Description: microtubule end binding protein complex
PDB Compounds: (C:) Uncharacterized protein

SCOPe Domain Sequences for d5n74c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n74c_ a.245.1.1 (C:) Microtubule-associated protein EB1, C-terminal dimerization domain {Otolemur garnettii [TaxId: 30611]}
aelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya

SCOPe Domain Coordinates for d5n74c_:

Click to download the PDB-style file with coordinates for d5n74c_.
(The format of our PDB-style files is described here.)

Timeline for d5n74c_: